Lineage for d1v92a_ (1v92 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984758Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1984917Family a.5.2.3: TAP-C domain-like [68973] (2 protein domains)
  6. 1984922Protein NSFL1 (p97 ATPase) cofactor p47, UBA-like domain [101067] (1 species)
  7. 1984923Species Norway rat (Rattus norvegicus) [TaxId:10116] [101068] (1 PDB entry)
  8. 1984924Domain d1v92a_: 1v92 A: [100531]

Details for d1v92a_

PDB Entry: 1v92 (more details)

PDB Description: Solution structure of the UBA domain from p47, a major cofactor of the AAA ATPase p97
PDB Compounds: (A:) NSFL1 cofactor p47

SCOPe Domain Sequences for d1v92a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
maeerqdalrefvavtgaeedrarfflesagwdlqialasfyedgg

SCOPe Domain Coordinates for d1v92a_:

Click to download the PDB-style file with coordinates for d1v92a_.
(The format of our PDB-style files is described here.)

Timeline for d1v92a_: