Lineage for d1v8pl_ (1v8p L:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595148Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 595149Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 595150Family c.120.1.1: PIN domain [89619] (3 proteins)
    Pfam 01850
  6. 595157Protein Hypothetical protein PAE2754 [102270] (1 species)
  7. 595158Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [102271] (2 PDB entries)
  8. 595170Domain d1v8pl_: 1v8p L: [100530]
    structural genomics
    complexed with cl; mutant

Details for d1v8pl_

PDB Entry: 1v8p (more details), 2.52 Å

PDB Description: crystal structure of pae2754 from pyrobaculum aerophilum

SCOP Domain Sequences for d1v8pl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8pl_ c.120.1.1 (L:) Hypothetical protein PAE2754 {Archaeon Pyrobaculum aerophilum}
aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
kkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkgai
dvetllvrlaaq

SCOP Domain Coordinates for d1v8pl_:

Click to download the PDB-style file with coordinates for d1v8pl_.
(The format of our PDB-style files is described here.)

Timeline for d1v8pl_: