Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (2 families) |
Family c.120.1.1: PIN domain [89619] (3 proteins) Pfam 01850 |
Protein Hypothetical protein PAE2754 [102270] (1 species) |
Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [102271] (2 PDB entries) |
Domain d1v8pl_: 1v8p L: [100530] structural genomics complexed with cl; mutant |
PDB Entry: 1v8p (more details), 2.52 Å
SCOP Domain Sequences for d1v8pl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8pl_ c.120.1.1 (L:) Hypothetical protein PAE2754 {Archaeon Pyrobaculum aerophilum} aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl kkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkgai dvetllvrlaaq
Timeline for d1v8pl_: