Lineage for d1v8pl_ (1v8p L:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921858Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2921859Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. 2921860Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 2921870Protein Hypothetical protein PAE2754 [102270] (1 species)
  7. 2921871Species Pyrobaculum aerophilum [TaxId:13773] [102271] (2 PDB entries)
  8. 2921883Domain d1v8pl_: 1v8p L: [100530]
    Other proteins in same PDB: d1v8pb2, d1v8pc2, d1v8pd2, d1v8pf2, d1v8pg2
    structural genomics
    complexed with cl

Details for d1v8pl_

PDB Entry: 1v8p (more details), 2.52 Å

PDB Description: crystal structure of pae2754 from pyrobaculum aerophilum
PDB Compounds: (L:) hypothetical protein PAE2754

SCOPe Domain Sequences for d1v8pl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8pl_ c.120.1.1 (L:) Hypothetical protein PAE2754 {Pyrobaculum aerophilum [TaxId: 13773]}
aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
kkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkgai
dvetllvrlaaq

SCOPe Domain Coordinates for d1v8pl_:

Click to download the PDB-style file with coordinates for d1v8pl_.
(The format of our PDB-style files is described here.)

Timeline for d1v8pl_: