Lineage for d1v8pg_ (1v8p G:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885042Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 1885043Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 1885044Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 1885054Protein Hypothetical protein PAE2754 [102270] (1 species)
  7. 1885055Species Pyrobaculum aerophilum [TaxId:13773] [102271] (2 PDB entries)
  8. 1885062Domain d1v8pg_: 1v8p G: [100525]
    structural genomics
    complexed with cl

Details for d1v8pg_

PDB Entry: 1v8p (more details), 2.52 Å

PDB Description: Crystal structure of PAE2754 from Pyrobaculum aerophilum
PDB Compounds: (G:) hypothetical protein PAE2754

SCOPe Domain Sequences for d1v8pg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8pg_ c.120.1.1 (G:) Hypothetical protein PAE2754 {Pyrobaculum aerophilum [TaxId: 13773]}
maveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrh
lkkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkga
idvetllvrlaaq

SCOPe Domain Coordinates for d1v8pg_:

Click to download the PDB-style file with coordinates for d1v8pg_.
(The format of our PDB-style files is described here.)

Timeline for d1v8pg_: