Lineage for d1v8pf_ (1v8p F:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712940Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 712941Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 712942Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 712952Protein Hypothetical protein PAE2754 [102270] (1 species)
  7. 712953Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [102271] (2 PDB entries)
  8. 712959Domain d1v8pf_: 1v8p F: [100524]

Details for d1v8pf_

PDB Entry: 1v8p (more details), 2.52 Å

PDB Description: crystal structure of pae2754 from pyrobaculum aerophilum
PDB Compounds: (F:) hypothetical protein PAE2754

SCOP Domain Sequences for d1v8pf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8pf_ c.120.1.1 (F:) Hypothetical protein PAE2754 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
pttenlyfqgamaveylvdasalyalaahydkwikhreklailhltiyeagnalwkearl
grvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtq
drellaktkgaidvetllvrlaaq

SCOP Domain Coordinates for d1v8pf_:

Click to download the PDB-style file with coordinates for d1v8pf_.
(The format of our PDB-style files is described here.)

Timeline for d1v8pf_: