Lineage for d1v8pa_ (1v8p A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. Protein Hypothetical protein PAE2754 [102270] (1 species)
  7. Species Pyrobaculum aerophilum [TaxId:13773] [102271] (2 PDB entries)
  8. Domain d1v8pa_: 1v8p A: [100519]
    Other proteins in same PDB: d1v8pb2, d1v8pc2, d1v8pd2, d1v8pf2, d1v8pg2
    structural genomics
    complexed with cl

Details for d1v8pa_

PDB Entry: 1v8p (more details), 2.52 Å

PDB Description: Crystal structure of PAE2754 from Pyrobaculum aerophilum
PDB Compounds: (A:) hypothetical protein PAE2754

SCOPe Domain Sequences for d1v8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8pa_ c.120.1.1 (A:) Hypothetical protein PAE2754 {Pyrobaculum aerophilum [TaxId: 13773]}
aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
kkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkgai
dvetllvrlaaq

SCOPe Domain Coordinates for d1v8pa_ are not available.

Timeline for d1v8pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v8pb1, d1v8pb2, d1v8pc1, d1v8pc2, d1v8pd1, d1v8pd2, d1v8pe_, d1v8pf1, d1v8pf2, d1v8pg1, d1v8pg2, d1v8ph_, d1v8pi_, d1v8pj_, d1v8pk_, d1v8pl_