Lineage for d1v8og_ (1v8o G:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529111Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2529112Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2529113Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 2529123Protein Hypothetical protein PAE2754 [102270] (1 species)
  7. 2529124Species Pyrobaculum aerophilum [TaxId:13773] [102271] (2 PDB entries)
  8. 2529143Domain d1v8og_: 1v8o G: [100517]
    Other proteins in same PDB: d1v8ob2, d1v8oc2, d1v8of2, d1v8oh2
    complexed with cl

Details for d1v8og_

PDB Entry: 1v8o (more details), 2.8 Å

PDB Description: crystal structure of pae2754 from pyrobaculum aerophilum
PDB Compounds: (G:) hypothetical protein PAE2754

SCOPe Domain Sequences for d1v8og_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8og_ c.120.1.1 (G:) Hypothetical protein PAE2754 {Pyrobaculum aerophilum [TaxId: 13773]}
aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
kkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktkgai
dvetllvrlaaq

SCOPe Domain Coordinates for d1v8og_:

Click to download the PDB-style file with coordinates for d1v8og_.
(The format of our PDB-style files is described here.)

Timeline for d1v8og_: