Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (2 families) |
Family c.120.1.1: PIN domain [89619] (2 proteins) |
Protein Hypothetical protein PAE2754 [102270] (1 species) |
Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [102271] (2 PDB entries) |
Domain d1v8og_: 1v8o G: [100517] |
PDB Entry: 1v8o (more details), 2.8 Å
SCOP Domain Sequences for d1v8og_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8og_ c.120.1.1 (G:) Hypothetical protein PAE2754 {Archaeon Pyrobaculum aerophilum} aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl kkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktkgai dvetllvrlaaq
Timeline for d1v8og_: