Lineage for d1v8oc_ (1v8o C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404812Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 404813Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 404814Family c.120.1.1: PIN domain [89619] (2 proteins)
  6. 404818Protein Hypothetical protein PAE2754 [102270] (1 species)
  7. 404819Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [102271] (2 PDB entries)
  8. 404834Domain d1v8oc_: 1v8o C: [100513]

Details for d1v8oc_

PDB Entry: 1v8o (more details), 2.8 Å

PDB Description: crystal structure of pae2754 from pyrobaculum aerophilum

SCOP Domain Sequences for d1v8oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8oc_ c.120.1.1 (C:) Hypothetical protein PAE2754 {Archaeon Pyrobaculum aerophilum}
gamaveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaas
rhlkkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktk
gaidvetllvrlaaq

SCOP Domain Coordinates for d1v8oc_:

Click to download the PDB-style file with coordinates for d1v8oc_.
(The format of our PDB-style files is described here.)

Timeline for d1v8oc_: