Lineage for d1v8ka_ (1v8k A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111569Protein Kinesin [52646] (7 species)
  7. 2111620Species Mouse (Mus musculus), kif2c [TaxId:10090] [102370] (2 PDB entries)
  8. 2111621Domain d1v8ka_: 1v8k A: [100510]
    complexed with anp, mg

Details for d1v8ka_

PDB Entry: 1v8k (more details), 2.25 Å

PDB Description: The Crystal Structure of the Minimal Functional Domain of the Microtubule Destabilizer KIF2C Complexed with Mg-AMPPNP
PDB Compounds: (A:) Kinesin-like protein KIF2C

SCOPe Domain Sequences for d1v8ka_:

Sequence, based on SEQRES records: (download)

>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]}
pnwefarmikefrvtmecspltvtdpieehricvcvrkrplnkqelakkeidvisvpskc
lllvhepklkvdltkylenqafcfdfafdetasnevvyrftarplvqtifeggkatcfay
gqtgsgkthtmggdlsgksqnaskgiyamasrdvfllknqpryrnlnlevyvtffeiyng
kvfdllnkkaklrvledsrqqvqvvglqeylvtcaddvikminmgsacrtsgqtfansns
srshacfqillrtkgrlhgkfslvdlagnergadtssadrqtrmegaeinksllalkeci
ralgqnkahtpfreskltqvlrdsfigensrtcmiamispgissceytlntlryadrvke
ls

Sequence, based on observed residues (ATOM records): (download)

>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]}
pnwefarmikefrvtmecspltvtdpieehricvcvrkrplnkqelakkeidvisvpskc
lllvhepklkvdltkylenqafcfdfafdetasnevvyrftarplvqtifeggkatcfay
gqtgsgkthtmggdlqnaskgiyamasrdvfllknqpryrnlnlevyvtffeiyngkvfd
llnkkaklrvledsrqqvqvvglqeylvtcaddvikminmgsacrtnssrshacfqillr
tkgrlhgkfslvdlagnermegaeinksllalkeciralgqfreskltqvlrdsfigens
rtcmiamispgissceytlntlryadrvkels

SCOPe Domain Coordinates for d1v8ka_:

Click to download the PDB-style file with coordinates for d1v8ka_.
(The format of our PDB-style files is described here.)

Timeline for d1v8ka_: