Lineage for d1v8gb1 (1v8g B:1-65)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443815Fold a.46: Methionine synthase domain-like [47643] (2 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 443824Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) (S)
  5. 443825Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 443826Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. 443843Species Thermus thermophilus [TaxId:274] [101213] (1 PDB entry)
  8. 443845Domain d1v8gb1: 1v8g B:1-65 [100507]
    Other proteins in same PDB: d1v8ga2, d1v8gb2

Details for d1v8gb1

PDB Entry: 1v8g (more details), 2.1 Å

PDB Description: Crystal structure of anthranilate phosphoribosyltransferase (TrpD) from Thermus thermophilus HB8

SCOP Domain Sequences for d1v8gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8gb1 a.46.2.1 (B:1-65) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus}
mdavkkailgevleeeeayevmralmagevspvraagllvalslrgerpheiaamaramr
eaarp

SCOP Domain Coordinates for d1v8gb1:

Click to download the PDB-style file with coordinates for d1v8gb1.
(The format of our PDB-style files is described here.)

Timeline for d1v8gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v8gb2