Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins) contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family automatically mapped to Pfam PF02569 |
Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species) |
Species Thermus thermophilus [TaxId:274] [89616] (2 PDB entries) |
Domain d1v8fb_: 1v8f B: [100504] structural genomics complexed with 144, cl, gol, p6g |
PDB Entry: 1v8f (more details), 1.9 Å
SCOPe Domain Sequences for d1v8fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8fb_ c.26.1.4 (B:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]} mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvvsvfvnplqfgpg edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv hpetllplsdwvagargivagrfpearlidnlevyp
Timeline for d1v8fb_: