SCOPe 2.07: Domain d1v8fb_: 1v8f B:

Lineage for d1v8fb_ (1v8f B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
   automatically mapped to Pfam PF02569

6. Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)

7. Species Thermus thermophilus [TaxId:274] [89616] (2 PDB entries)

8. Domain d1v8fb_: 1v8f B: [100504]
   structural genomics
   complexed with 144, cl, gol, p6g

Details for d1v8fb_

PDB Entry: 1v8f, 1.9 Å

PDB Description: Crystal Structure of Pantoate-beta-Alanine (Pantothenate Synthetase) from Thermus Thermophilus HB8

PDB Compounds: (B:) Pantoate-beta-alanine ligase

SCOPe Domain Sequences for d1v8fb_:

Sequence; same for both SEQRES and ATOM records:

>d1v8fb_ c.26.1.4 (B:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]}
mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvvsvfvnplqfgpg
edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh
fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal
ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv
hpetllplsdwvagargivagrfpearlidnlevyp

Timeline for d1v8fb_:

• d1v8fb_ first appeared in SCOP 1.67
  
• d1v8fb_ appears in SCOPe 2.06
  
• d1v8fb_ appears in the current release, SCOPe 2.08