Lineage for d1v8fb_ (1v8f B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841835Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
    automatically mapped to Pfam PF02569
  6. 1841836Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)
  7. 1841941Species Thermus thermophilus [TaxId:274] [89616] (2 PDB entries)
  8. 1841943Domain d1v8fb_: 1v8f B: [100504]
    structural genomics
    complexed with 144, cl, gol, p6g

Details for d1v8fb_

PDB Entry: 1v8f (more details), 1.9 Å

PDB Description: Crystal Structure of Pantoate-beta-Alanine (Pantothenate Synthetase) from Thermus Thermophilus HB8
PDB Compounds: (B:) Pantoate-beta-alanine ligase

SCOPe Domain Sequences for d1v8fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8fb_ c.26.1.4 (B:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]}
mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvvsvfvnplqfgpg
edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh
fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal
ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv
hpetllplsdwvagargivagrfpearlidnlevyp

SCOPe Domain Coordinates for d1v8fb_:

Click to download the PDB-style file with coordinates for d1v8fb_.
(The format of our PDB-style files is described here.)

Timeline for d1v8fb_: