Lineage for d1v8fa_ (1v8f A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482378Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 482379Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 482640Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (1 protein)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
  6. 482641Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (3 species)
  7. 482662Species Thermus thermophilus [TaxId:274] [89616] (2 PDB entries)
  8. 482663Domain d1v8fa_: 1v8f A: [100503]

Details for d1v8fa_

PDB Entry: 1v8f (more details), 1.9 Å

PDB Description: Crystal Structure of Pantoate-beta-Alanine (Pantothenate Synthetase) from Thermus Thermophilus HB8

SCOP Domain Sequences for d1v8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8fa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus}
mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvvsvfvnplqfgpg
edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh
fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal
ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv
hpetllplsdwvagargivagrfpearlidnlevyp

SCOP Domain Coordinates for d1v8fa_:

Click to download the PDB-style file with coordinates for d1v8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1v8fa_: