SCOP 1.69: Domain d1v8cd2: 1v8c D:88-165

Lineage for d1v8cd2 (1v8c D:88-165)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.129: TBP-like [55944] (8 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.5: MoaD-related protein, C-terminal domain [103239] (1 family)
   contains a single copy of this fold

5. Family d.129.5.1: MoaD-related protein, C-terminal domain [103240] (1 protein)

6. Protein MoaD-related protein, C-terminal domain [103241] (1 species)

7. Species Thermus thermophilus [TaxId:274] [103242] (1 PDB entry)

8. Domain d1v8cd2: 1v8c D:88-165 [100502]
   Other proteins in same PDB: d1v8ca1, d1v8cb1, d1v8cc1, d1v8cd1

Details for d1v8cd2

PDB Entry: 1v8c, 1.6 Å

PDB Description: Crystal Structure of MoaD related protein from Thermus thermophilus HB8

SCOP Domain Sequences for d1v8cd2:

Sequence; same for both SEQRES and ATOM records:

>d1v8cd2 d.129.5.1 (D:88-165) MoaD-related protein, C-terminal domain {Thermus thermophilus}
gfertfgafppwlleryleewggtregegvyrlpgavvrfreveplkvgslsipqlrvev
egeeaerwferiafaasr

Timeline for d1v8cd2:

• d1v8cd2 first appeared in SCOP 1.67
  
• d1v8cd2 appears in SCOP 1.71
  
• d1v8cd2 appears in the current release, SCOPe 2.08