Lineage for d1v8cd1 (1v8c D:1-87)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 408066Superfamily d.15.3: MoaD/ThiS [54285] (2 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 408067Family d.15.3.1: MoaD [54286] (2 proteins)
  6. 408068Protein MoaD-related protein, N-terminal domain [102794] (1 species)
  7. 408069Species Thermus thermophilus [TaxId:274] [102795] (1 PDB entry)
  8. 408073Domain d1v8cd1: 1v8c D:1-87 [100501]
    Other proteins in same PDB: d1v8ca2, d1v8cb2, d1v8cc2, d1v8cd2
    complexed with cl, egl

Details for d1v8cd1

PDB Entry: 1v8c (more details), 1.6 Å

PDB Description: Crystal Structure of MoaD related protein from Thermus thermophilus HB8

SCOP Domain Sequences for d1v8cd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8cd1 d.15.3.1 (D:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus}
pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
dvrylqglstplspgatldlfppvagg

SCOP Domain Coordinates for d1v8cd1:

Click to download the PDB-style file with coordinates for d1v8cd1.
(The format of our PDB-style files is described here.)

Timeline for d1v8cd1: