Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.5: MoaD-related protein, C-terminal domain [103239] (1 family) contains a single copy of this fold automatically mapped to Pfam PF09189 |
Family d.129.5.1: MoaD-related protein, C-terminal domain [103240] (1 protein) |
Protein MoaD-related protein, C-terminal domain [103241] (1 species) |
Species Thermus thermophilus [TaxId:274] [103242] (1 PDB entry) |
Domain d1v8cb2: 1v8c B:88-164 [100498] Other proteins in same PDB: d1v8ca1, d1v8cb1, d1v8cc1, d1v8cd1 complexed with cl, edo |
PDB Entry: 1v8c (more details), 1.6 Å
SCOPe Domain Sequences for d1v8cb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8cb2 d.129.5.1 (B:88-164) MoaD-related protein, C-terminal domain {Thermus thermophilus [TaxId: 274]} gfertfgafppwlleryleewggtregegvyrlpgavvrfreveplkvgslsipqlrvev egeeaerwferiafaas
Timeline for d1v8cb2: