SCOP 1.69: Domain d1v8cb1: 1v8c B:1-83

Lineage for d1v8cb1 (1v8c B:1-83)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (2 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.1: MoaD [54286] (2 proteins)

6. Protein MoaD-related protein, N-terminal domain [102794] (1 species)

7. Species Thermus thermophilus [TaxId:274] [102795] (1 PDB entry)

8. Domain d1v8cb1: 1v8c B:1-83 [100497]
   Other proteins in same PDB: d1v8ca2, d1v8cb2, d1v8cc2, d1v8cd2

Details for d1v8cb1

PDB Entry: 1v8c, 1.6 Å

PDB Description: Crystal Structure of MoaD related protein from Thermus thermophilus HB8

SCOP Domain Sequences for d1v8cb1:

Sequence; same for both SEQRES and ATOM records:

>d1v8cb1 d.15.3.1 (B:1-83) MoaD-related protein, N-terminal domain {Thermus thermophilus}
pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
dvrylqglstplspgatldlfpp

Timeline for d1v8cb1:

• d1v8cb1 first appeared in SCOP 1.67
  
• d1v8cb1 appears in SCOP 1.71
  
• d1v8cb1 appears in the current release, SCOPe 2.08