Lineage for d1v7zf_ (1v7z F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922751Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2922752Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 2922753Family c.125.1.1: Creatininase [102216] (2 proteins)
  6. 2922754Protein Creatininase [102217] (1 species)
  7. 2922755Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 2922761Domain d1v7zf_: 1v7z F: [100493]
    complexed with crn, mn, so4, zn

Details for d1v7zf_

PDB Entry: 1v7z (more details), 1.6 Å

PDB Description: creatininase-product complex
PDB Compounds: (F:) creatinine amidohydrolase

SCOPe Domain Sequences for d1v7zf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7zf_ c.125.1.1 (F:) Creatininase {Pseudomonas putida [TaxId: 303]}
ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvf
etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
evcvqgiadaireefpp

SCOPe Domain Coordinates for d1v7zf_:

Click to download the PDB-style file with coordinates for d1v7zf_.
(The format of our PDB-style files is described here.)

Timeline for d1v7zf_: