Lineage for d1v7zb_ (1v7z B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 405035Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 405036Superfamily c.125.1: Creatininase [102215] (1 family) (S)
  5. 405037Family c.125.1.1: Creatininase [102216] (1 protein)
  6. 405038Protein Creatininase [102217] (1 species)
  7. 405039Species Pseudomonas putida [TaxId:303] [102218] (4 PDB entries)
  8. 405041Domain d1v7zb_: 1v7z B: [100489]

Details for d1v7zb_

PDB Entry: 1v7z (more details), 1.6 Å

PDB Description: creatininase-product complex

SCOP Domain Sequences for d1v7zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7zb_ c.125.1.1 (B:) Creatininase {Pseudomonas putida}
ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvf
etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
evcvqgiadaireefpp

SCOP Domain Coordinates for d1v7zb_:

Click to download the PDB-style file with coordinates for d1v7zb_.
(The format of our PDB-style files is described here.)

Timeline for d1v7zb_: