Lineage for d1v7ub_ (1v7u B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712075Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 712076Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 712077Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein)
  6. 712078Protein Undecaprenyl diphosphate synthase [64007] (2 species)
  7. 712079Species Escherichia coli [TaxId:562] [64009] (10 PDB entries)
  8. 712094Domain d1v7ub_: 1v7u B: [100487]
    complexed with fpp

Details for d1v7ub_

PDB Entry: 1v7u (more details), 2.35 Å

PDB Description: Crystal structure of Undecaprenyl Pyrophosphate Synthase with farnesyl pyrophosphate
PDB Compounds: (B:) Undecaprenyl pyrophosphate synthetase

SCOP Domain Sequences for d1v7ub_:

Sequence, based on SEQRES records: (download)

>d1v7ub_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Sequence, based on observed residues (ATOM records): (download)

>d1v7ub_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssepaq
evsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltln
iaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehr
isnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

SCOP Domain Coordinates for d1v7ub_:

Click to download the PDB-style file with coordinates for d1v7ub_.
(The format of our PDB-style files is described here.)

Timeline for d1v7ub_: