SCOP 1.69: Domain d1v7ub_: 1v7u B:

Lineage for d1v7ub_ (1v7u B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein)

6. Protein Undecaprenyl diphosphate synthase [64007] (2 species)

7. Species Escherichia coli [TaxId:562] [64009] (3 PDB entries)

8. Domain d1v7ub_: 1v7u B: [100487]

Details for d1v7ub_

PDB Entry: 1v7u, 2.35 Å

PDB Description: Crystal structure of Undecaprenyl Pyrophosphate Synthase with farnesyl pyrophosphate

SCOP Domain Sequences for d1v7ub_:

Sequence, based on SEQRES records:

>d1v7ub_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Sequence, based on observed residues (ATOM records):

>d1v7ub_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssepaq
evsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltln
iaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehr
isnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Timeline for d1v7ub_:

• d1v7ub_ first appeared in SCOP 1.67
  
• d1v7ub_ appears in SCOP 1.71
  
• d1v7ub_ appears in the current release, SCOPe 2.08