Lineage for d1v7ra_ (1v7r A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856157Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1856374Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 1856375Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
    Pfam PF01725
  6. 1856390Protein XTP pyrophosphatase [52974] (2 species)
  7. 1856396Species Pyrococcus horikoshii [TaxId:53953] [102470] (6 PDB entries)
    PH1917
  8. 1856397Domain d1v7ra_: 1v7r A: [100482]
    structural genomics
    complexed with cit

Details for d1v7ra_

PDB Entry: 1v7r (more details), 1.4 Å

PDB Description: Structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii OT3
PDB Compounds: (A:) Hypothetical protein PH1917

SCOPe Domain Sequences for d1v7ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7ra_ c.51.4.1 (A:) XTP pyrophosphatase {Pyrococcus horikoshii [TaxId: 53953]}
mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpep
fmiedsglfieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkay
kfsgvtwgrisnekrgthgfgydpifipegsektfaemtieeknalshrgkalkaffewl
kvnlky

SCOPe Domain Coordinates for d1v7ra_:

Click to download the PDB-style file with coordinates for d1v7ra_.
(The format of our PDB-style files is described here.)

Timeline for d1v7ra_: