| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) ![]() formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
| Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins) Pfam PF01725 |
| Protein XTP pyrophosphatase [52974] (2 species) |
| Species Pyrococcus horikoshii [TaxId:53953] [102470] (7 PDB entries) PH1917 |
| Domain d1v7ra_: 1v7r A: [100482] structural genomics complexed with cit |
PDB Entry: 1v7r (more details), 1.4 Å
SCOPe Domain Sequences for d1v7ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v7ra_ c.51.4.1 (A:) XTP pyrophosphatase {Pyrococcus horikoshii [TaxId: 53953]}
mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpep
fmiedsglfieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkay
kfsgvtwgrisnekrgthgfgydpifipegsektfaemtieeknalshrgkalkaffewl
kvnlky
Timeline for d1v7ra_: