Lineage for d1v7oa_ (1v7o A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956973Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2956974Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) (S)
    putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)
  5. 2956988Family d.67.1.2: AlaX-like [103051] (3 proteins)
  6. 2956992Protein Hypothetical protein PH0574 [103052] (1 species)
    stand-alone protein related to the AlaRS domain
  7. 2956993Species Pyrococcus horikoshii [TaxId:53953] [103053] (4 PDB entries)
    Uniprot P27248
  8. 2957000Domain d1v7oa_: 1v7o A: [100480]

Details for d1v7oa_

PDB Entry: 1v7o (more details), 2.62 Å

PDB Description: Alanyl-tRNA synthetase editing domain homologue protein from Pyrococcus horikoshii
PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d1v7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7oa_ d.67.1.2 (A:) Hypothetical protein PH0574 {Pyrococcus horikoshii [TaxId: 53953]}
mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
tkttgeigpikirkvrfrkskglleihfellelen

SCOPe Domain Coordinates for d1v7oa_:

Click to download the PDB-style file with coordinates for d1v7oa_.
(The format of our PDB-style files is described here.)

Timeline for d1v7oa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v7ob_