Lineage for d1v7nz_ (1v7n Z:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1730528Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1730529Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1730619Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1730763Protein Thrombopoietin [101140] (1 species)
    long chain cytokine with a short-chain cytokine topology
  7. 1730764Species Human (Homo sapiens) [TaxId:9606] [101141] (2 PDB entries)
  8. 1730770Domain d1v7nz_: 1v7n Z: [100479]
    Other proteins in same PDB: d1v7nh1, d1v7nh2, d1v7ni1, d1v7ni2, d1v7nj1, d1v7nj2, d1v7nk1, d1v7nk2, d1v7nl1, d1v7nl2, d1v7nm1, d1v7nm2, d1v7nn1, d1v7nn2, d1v7no1, d1v7no2

Details for d1v7nz_

PDB Entry: 1v7n (more details), 3.3 Å

PDB Description: human thrombopoietin functional domain complexed to neutralizing antibody tn1 fab
PDB Compounds: (Z:) Thrombopoietin

SCOPe Domain Sequences for d1v7nz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7nz_ a.26.1.2 (Z:) Thrombopoietin {Human (Homo sapiens) [TaxId: 9606]}
lrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilgavt
lllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrttahkdpnaif
lsfqhllrgkvrflmlvg

SCOPe Domain Coordinates for d1v7nz_:

Click to download the PDB-style file with coordinates for d1v7nz_.
(The format of our PDB-style files is described here.)

Timeline for d1v7nz_: