Lineage for d1v7nl2 (1v7n L:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2749038Species Mouse (Mus musculus) [TaxId:10090] [88567] (374 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2749441Domain d1v7nl2: 1v7n L:108-213 [100469]
    Other proteins in same PDB: d1v7nh1, d1v7nh2, d1v7ni1, d1v7ni2, d1v7nj1, d1v7nj2, d1v7nk1, d1v7nk2, d1v7nl1, d1v7nm1, d1v7nn1, d1v7no1, d1v7nv_, d1v7nx_, d1v7ny_, d1v7nz_
    part of anti-trombopoetin Fab tn1

Details for d1v7nl2

PDB Entry: 1v7n (more details), 3.3 Å

PDB Description: human thrombopoietin functional domain complexed to neutralizing antibody tn1 fab
PDB Compounds: (L:) Monoclonal TN1 Fab Light Chain

SCOPe Domain Sequences for d1v7nl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7nl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1v7nl2:

Click to download the PDB-style file with coordinates for d1v7nl2.
(The format of our PDB-style files is described here.)

Timeline for d1v7nl2: