Lineage for d1v7nl1 (1v7n L:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1289118Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (52 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 1289170Domain d1v7nl1: 1v7n L:1-107 [100468]
    Other proteins in same PDB: d1v7nh1, d1v7nh2, d1v7ni1, d1v7ni2, d1v7nj1, d1v7nj2, d1v7nk1, d1v7nk2, d1v7nl2, d1v7nm2, d1v7nn2, d1v7no2, d1v7nv_, d1v7nx_, d1v7ny_, d1v7nz_
    part of anti-trombopoetin Fab tn1

Details for d1v7nl1

PDB Entry: 1v7n (more details), 3.3 Å

PDB Description: human thrombopoietin functional domain complexed to neutralizing antibody tn1 fab
PDB Compounds: (L:) Monoclonal TN1 Fab Light Chain

SCOPe Domain Sequences for d1v7nl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7nl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikr

SCOPe Domain Coordinates for d1v7nl1:

Click to download the PDB-style file with coordinates for d1v7nl1.
(The format of our PDB-style files is described here.)

Timeline for d1v7nl1: