Lineage for d1v7nj2 (1v7n J:117-217)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655739Domain d1v7nj2: 1v7n J:117-217 [100465]
    Other proteins in same PDB: d1v7nh1, d1v7ni1, d1v7nj1, d1v7nk1, d1v7nl1, d1v7nl2, d1v7nm1, d1v7nm2, d1v7nn1, d1v7nn2, d1v7no1, d1v7no2, d1v7nv_, d1v7nx_, d1v7ny_, d1v7nz_

Details for d1v7nj2

PDB Entry: 1v7n (more details), 3.3 Å

PDB Description: Human Thrombopoietin Functional Domain Complexed To Neutralizing Antibody TN1 Fab
PDB Compounds: (J:) Monoclonal TN1 Fab Heavy Chain

SCOP Domain Sequences for d1v7nj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7nj2 b.1.1.2 (J:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1v7nj2:

Click to download the PDB-style file with coordinates for d1v7nj2.
(The format of our PDB-style files is described here.)

Timeline for d1v7nj2: