Class a: All alpha proteins [46456] (202 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (11 proteins) |
Protein Thrombopoietin [101140] (1 species) long chain cytokine with a short-chain cytokine topology |
Species Human (Homo sapiens) [TaxId:9606] [101141] (2 PDB entries) |
Domain d1v7mx_: 1v7m X: [100459] Other proteins in same PDB: d1v7mh1, d1v7mh2, d1v7mi1, d1v7mi2, d1v7ml1, d1v7ml2, d1v7mm1, d1v7mm2 |
PDB Entry: 1v7m (more details), 2.51 Å
SCOP Domain Sequences for d1v7mx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v7mx_ a.26.1.2 (X:) Thrombopoietin {Human (Homo sapiens)} cdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilga vtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlppqgrttahkdpna iflsfqhllrgkvrflmlvggstlc
Timeline for d1v7mx_: