Lineage for d1v7mv_ (1v7m V:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441656Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 441657Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 441725Family a.26.1.2: Short-chain cytokines [47286] (11 proteins)
  6. 441805Protein Thrombopoietin [101140] (1 species)
    long chain cytokine with a short-chain cytokine topology
  7. 441806Species Human (Homo sapiens) [TaxId:9606] [101141] (2 PDB entries)
  8. 441807Domain d1v7mv_: 1v7m V: [100458]
    Other proteins in same PDB: d1v7mh1, d1v7mh2, d1v7mi1, d1v7mi2, d1v7ml1, d1v7ml2, d1v7mm1, d1v7mm2

Details for d1v7mv_

PDB Entry: 1v7m (more details), 2.51 Å

PDB Description: Human Thrombopoietin Functional Domain Complexed To Neutralizing Antibody TN1 Fab

SCOP Domain Sequences for d1v7mv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7mv_ a.26.1.2 (V:) Thrombopoietin {Human (Homo sapiens)}
cdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilga
vtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlppqgrttahkdpna
iflsfqhllrgkvrflmlvggstlc

SCOP Domain Coordinates for d1v7mv_:

Click to download the PDB-style file with coordinates for d1v7mv_.
(The format of our PDB-style files is described here.)

Timeline for d1v7mv_: