SCOP 1.71: Domain d1v7mi2: 1v7m I:117-217

Lineage for d1v7mi2 (1v7m I:117-217)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1v7mi2: 1v7m I:117-217 [100453]
   Other proteins in same PDB: d1v7mh1, d1v7mi1, d1v7ml1, d1v7ml2, d1v7mm1, d1v7mm2, d1v7mv_, d1v7mx_
   part of anti-trombopoetin Fab tn1

Details for d1v7mi2

PDB Entry: 1v7m, 2.51 Å

PDB Description: Human Thrombopoietin Functional Domain Complexed To Neutralizing Antibody TN1 Fab

SCOP Domain Sequences for d1v7mi2:

Sequence; same for both SEQRES and ATOM records:

>d1v7mi2 b.1.1.2 (I:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

Timeline for d1v7mi2:

• d1v7mi2 first appeared in SCOP 1.67
  
• d1v7mi2 appears in SCOP 1.69
  
• d1v7mi2 appears in SCOP 1.73
  
• d1v7mi2 appears in the current release, SCOPe 2.08