| Class b: All beta proteins [48724] (141 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
| Domain d1v7mh2: 1v7m H:117-217 [100451] Other proteins in same PDB: d1v7mh1, d1v7mi1, d1v7ml1, d1v7ml2, d1v7mm1, d1v7mm2, d1v7mv_, d1v7mx_ |
PDB Entry: 1v7m (more details), 2.51 Å
SCOP Domain Sequences for d1v7mh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v7mh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
Timeline for d1v7mh2: