![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins) |
![]() | Protein Threonine synthase [64172] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102667] (3 PDB entries) |
![]() | Domain d1v7cd_: 1v7c D: [100449] complexed with hey |
PDB Entry: 1v7c (more details), 2 Å
SCOP Domain Sequences for d1v7cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v7cd_ c.79.1.1 (D:) Threonine synthase {Thermus thermophilus} mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
Timeline for d1v7cd_: