Lineage for d1v7cb_ (1v7c B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493418Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 493419Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 493420Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)
  6. 493518Protein Threonine synthase [64172] (3 species)
  7. 493525Species Thermus thermophilus [TaxId:274] [102667] (3 PDB entries)
  8. 493527Domain d1v7cb_: 1v7c B: [100447]

Details for d1v7cb_

PDB Entry: 1v7c (more details), 2 Å

PDB Description: Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue

SCOP Domain Sequences for d1v7cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7cb_ c.79.1.1 (B:) Threonine synthase {Thermus thermophilus}
mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll

SCOP Domain Coordinates for d1v7cb_:

Click to download the PDB-style file with coordinates for d1v7cb_.
(The format of our PDB-style files is described here.)

Timeline for d1v7cb_: