Lineage for d1v75b_ (1v75 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531063Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 531064Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100977] (2 PDB entries)
  8. 531066Domain d1v75b_: 1v75 B: [100445]
    Other proteins in same PDB: d1v75a_
    complexed with hem

Details for d1v75b_

PDB Entry: 1v75 (more details), 2.02 Å

PDB Description: crystal structure of hemoglobin d from the aldabra giant tortoise (geochelone gigantea) at 2.0 a resolution

SCOP Domain Sequences for d1v75b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v75b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea)}
hwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakvl
ahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpke
ftpasqaawtklvnavahalal

SCOP Domain Coordinates for d1v75b_:

Click to download the PDB-style file with coordinates for d1v75b_.
(The format of our PDB-style files is described here.)

Timeline for d1v75b_: