Lineage for d1v75b_ (1v75 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687002Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100977] (3 PDB entries)
    Uniprot P83133
  8. 2687005Domain d1v75b_: 1v75 B: [100445]
    Other proteins in same PDB: d1v75a_
    complexed with hem

Details for d1v75b_

PDB Entry: 1v75 (more details), 2.02 Å

PDB Description: crystal structure of hemoglobin d from the aldabra giant tortoise (geochelone gigantea) at 2.0 a resolution
PDB Compounds: (B:) Hemoglobin A and D beta chain

SCOPe Domain Sequences for d1v75b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v75b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]}
hwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakvl
ahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpke
ftpasqaawtklvnavahalal

SCOPe Domain Coordinates for d1v75b_:

Click to download the PDB-style file with coordinates for d1v75b_.
(The format of our PDB-style files is described here.)

Timeline for d1v75b_: