![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (19 species) |
![]() | Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100976] (2 PDB entries) |
![]() | Domain d1v75a_: 1v75 A: [100444] Other proteins in same PDB: d1v75b_ complexed with hem |
PDB Entry: 1v75 (more details), 2.02 Å
SCOP Domain Sequences for d1v75a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v75a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea)} mlteddkqliqhvwekvlehqedfgaealermfivypstktyfphfdlhhdseqirhhgk kvvgalgdavkhidnlsatlselsnlhaynlrvdpvnfkllshcfqvvlgahlgreytpq vqvaydkflaavsavlaekyr
Timeline for d1v75a_: