SCOP 1.69: Domain d1v74b_: 1v74 B:

Lineage for d1v74b_ (1v74 B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.20: Colicin D immunity protein [101125] (1 family)

5. Family a.24.20.1: Colicin D immunity protein [101126] (1 protein)

6. Protein Colicin D immunity protein [101127] (1 species)
   tRNA-mimic

7. Species Escherichia coli [TaxId:562] [101128] (1 PDB entry)

8. Domain d1v74b_: 1v74 B: [100443]
   Other proteins in same PDB: d1v74a_

Details for d1v74b_

PDB Entry: 1v74, 2 Å

PDB Description: structure of the e. coli colicin d bound to its immunity protein immd

SCOP Domain Sequences for d1v74b_:

Sequence; same for both SEQRES and ATOM records:

>d1v74b_ a.24.20.1 (B:) Colicin D immunity protein {Escherichia coli}
mnkmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfep
dadranyeiddnglkvevrsilekfkl

Timeline for d1v74b_:

• d1v74b_ first appeared in SCOP 1.67
  
• d1v74b_ appears in SCOP 1.71
  
• d1v74b_ appears in the current release, SCOPe 2.08