![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.20: Colicin D immunity protein [101125] (1 family) ![]() |
![]() | Family a.24.20.1: Colicin D immunity protein [101126] (1 protein) |
![]() | Protein Colicin D immunity protein [101127] (1 species) tRNA-mimic |
![]() | Species Escherichia coli [TaxId:562] [101128] (1 PDB entry) |
![]() | Domain d1v74b_: 1v74 B: [100443] Other proteins in same PDB: d1v74a_ complexed with 1pe |
PDB Entry: 1v74 (more details), 2 Å
SCOP Domain Sequences for d1v74b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v74b_ a.24.20.1 (B:) Colicin D immunity protein {Escherichia coli} mnkmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfep dadranyeiddnglkvevrsilekfkl
Timeline for d1v74b_: