Lineage for d1v74b_ (1v74 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700634Superfamily a.24.20: Colicin D immunity protein [101125] (1 family) (S)
    automatically mapped to Pfam PF09204
  5. 2700635Family a.24.20.1: Colicin D immunity protein [101126] (2 proteins)
  6. 2700636Protein Colicin D immunity protein [101127] (1 species)
    tRNA-mimic
  7. 2700637Species Escherichia coli [TaxId:562] [101128] (1 PDB entry)
  8. 2700638Domain d1v74b_: 1v74 B: [100443]
    Other proteins in same PDB: d1v74a_
    complexed with 1pe

Details for d1v74b_

PDB Entry: 1v74 (more details), 2 Å

PDB Description: structure of the e. coli colicin d bound to its immunity protein immd
PDB Compounds: (B:) Colicin D immunity protein

SCOPe Domain Sequences for d1v74b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v74b_ a.24.20.1 (B:) Colicin D immunity protein {Escherichia coli [TaxId: 562]}
mnkmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfep
dadranyeiddnglkvevrsilekfkl

SCOPe Domain Coordinates for d1v74b_:

Click to download the PDB-style file with coordinates for d1v74b_.
(The format of our PDB-style files is described here.)

Timeline for d1v74b_: