Lineage for d1v74a_ (1v74 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516650Fold d.243: Colicin D nuclease domain [102823] (1 superfamily)
    alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander
  4. 516651Superfamily d.243.1: Colicin D nuclease domain [102824] (1 family) (S)
  5. 516652Family d.243.1.1: Colicin D nuclease domain [102825] (1 protein)
  6. 516653Protein Colicin D nuclease domain [102826] (1 species)
    tRNA-specific ribonuclease
  7. 516654Species Escherichia coli [TaxId:562] [102827] (1 PDB entry)
  8. 516655Domain d1v74a_: 1v74 A: [100442]
    Other proteins in same PDB: d1v74b_

Details for d1v74a_

PDB Entry: 1v74 (more details), 2 Å

PDB Description: structure of the e. coli colicin d bound to its immunity protein immd

SCOP Domain Sequences for d1v74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v74a_ d.243.1.1 (A:) Colicin D nuclease domain {Escherichia coli}
lndpldsgrfsrkqldkkykhagdfgisdtkknretltkfrdaieehlsdkdtvekgtyr
rekgskvyfnpntmnvviiksngeflsgwkinpdadngriyletgel

SCOP Domain Coordinates for d1v74a_:

Click to download the PDB-style file with coordinates for d1v74a_.
(The format of our PDB-style files is described here.)

Timeline for d1v74a_: