Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Xylanase A, catalytic core [51514] (8 species) |
Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (12 PDB entries) Uniprot Q7SI98 N-terminal domain; fused with a ricin A-like beta-trefoil domain |
Domain d1v6xb2: 1v6x B:501-803 [100441] Other proteins in same PDB: d1v6xa1, d1v6xb1 complexed with xyp |
PDB Entry: 1v6x (more details), 2.1 Å
SCOPe Domain Sequences for d1v6xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6xb2 c.1.8.3 (B:501-803) Xylanase A, catalytic core {Streptomyces olivaceoviridis [TaxId: 1921]} aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal ngg
Timeline for d1v6xb2: