Lineage for d1v6xb2 (1v6x B:501-803)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094224Protein Xylanase A, catalytic core [51514] (8 species)
  7. 2094280Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (12 PDB entries)
    Uniprot Q7SI98
    N-terminal domain; fused with a ricin A-like beta-trefoil domain
  8. 2094298Domain d1v6xb2: 1v6x B:501-803 [100441]
    Other proteins in same PDB: d1v6xa1, d1v6xb1
    complexed with xyp

Details for d1v6xb2

PDB Entry: 1v6x (more details), 2.1 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with 3(3)-4-o-methyl-alpha-d-glucuronosyl-xylotriose
PDB Compounds: (B:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d1v6xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6xb2 c.1.8.3 (B:501-803) Xylanase A, catalytic core {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOPe Domain Coordinates for d1v6xb2:

Click to download the PDB-style file with coordinates for d1v6xb2.
(The format of our PDB-style files is described here.)

Timeline for d1v6xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v6xb1