Lineage for d1v6xb1 (1v6x B:804-936)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375317Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 375486Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 375487Family b.42.2.1: Ricin B-like [50371] (3 proteins)
  6. 375524Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)
  7. 375529Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries)
  8. 375547Domain d1v6xb1: 1v6x B:804-936 [100440]
    Other proteins in same PDB: d1v6xa2, d1v6xb2
    complexed with gcv, xys

Details for d1v6xb1

PDB Entry: 1v6x (more details), 2.1 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with 3(3)-4-o-methyl-alpha-d-glucuronosyl-xylotriose

SCOP Domain Sequences for d1v6xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6xb1 b.42.2.1 (B:804-936) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis}
sstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygd
kcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqly
scsngsnqrwtrt

SCOP Domain Coordinates for d1v6xb1:

Click to download the PDB-style file with coordinates for d1v6xb1.
(The format of our PDB-style files is described here.)

Timeline for d1v6xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v6xb2