SCOPe 2.08: Domain d1v6xb1: 1v6x B:804-936

Lineage for d1v6xb1 (1v6x B:804-936)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)

7. Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries)

8. Domain d1v6xb1: 1v6x B:804-936 [100440]
   Other proteins in same PDB: d1v6xa2, d1v6xb2
   complexed with xyp

Details for d1v6xb1

PDB Entry: 1v6x, 2.1 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with 3(3)-4-o-methyl-alpha-d-glucuronosyl-xylotriose

PDB Compounds: (B:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d1v6xb1:

Sequence; same for both SEQRES and ATOM records:

>d1v6xb1 b.42.2.1 (B:804-936) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis [TaxId: 1921]}
sstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygd
kcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqly
scsngsnqrwtrt

Timeline for d1v6xb1:

• d1v6xb1 first appeared in SCOP 1.67
  
• d1v6xb1 appears in SCOPe 2.07