Lineage for d1v6wb2 (1v6w B:501-803)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474407Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 474700Protein Xylanase A, catalytic core [51514] (8 species)
  7. 474742Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (12 PDB entries)
    N-terminal domain; fused with a ricin A-like beta-trefoil domain
  8. 474744Domain d1v6wb2: 1v6w B:501-803 [100437]
    Other proteins in same PDB: d1v6wa1, d1v6wb1

Details for d1v6wb2

PDB Entry: 1v6w (more details), 2 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with 2(2)-4-o-methyl-alpha-d-glucuronosyl-xylobiose

SCOP Domain Sequences for d1v6wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6wb2 c.1.8.3 (B:501-803) Xylanase A, catalytic core {Streptomyces olivaceoviridis}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOP Domain Coordinates for d1v6wb2:

Click to download the PDB-style file with coordinates for d1v6wb2.
(The format of our PDB-style files is described here.)

Timeline for d1v6wb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v6wb1