Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species) |
Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries) |
Domain d1v6vb1: 1v6v B:804-936 [100432] Other proteins in same PDB: d1v6va2, d1v6vb2 complexed with xyp |
PDB Entry: 1v6v (more details), 2.1 Å
SCOPe Domain Sequences for d1v6vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6vb1 b.42.2.1 (B:804-936) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis [TaxId: 1921]} sstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygd kcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqly scsngsnqrwtrt
Timeline for d1v6vb1: