Lineage for d1v6ub1 (1v6u B:804-936)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560566Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 560747Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 560748Family b.42.2.1: Ricin B-like [50371] (7 proteins)
  6. 560814Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)
  7. 560819Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries)
  8. 560841Domain d1v6ub1: 1v6u B:804-936 [100428]
    Other proteins in same PDB: d1v6ua2, d1v6ub2
    complexed with ahr, xys

Details for d1v6ub1

PDB Entry: 1v6u (more details), 2.1 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with 2(2)-alpha-l-arabinofuranosyl-xylobiose

SCOP Domain Sequences for d1v6ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6ub1 b.42.2.1 (B:804-936) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis}
sstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygd
kcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqly
scsngsnqrwtrt

SCOP Domain Coordinates for d1v6ub1:

Click to download the PDB-style file with coordinates for d1v6ub1.
(The format of our PDB-style files is described here.)

Timeline for d1v6ub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v6ub2