Lineage for d1v6sb_ (1v6s B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 402789Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 402790Superfamily c.86.1: Phosphoglycerate kinase [53748] (1 family) (S)
  5. 402791Family c.86.1.1: Phosphoglycerate kinase [53749] (1 protein)
    Domain 2 binds ATP
  6. 402792Protein Phosphoglycerate kinase [53750] (7 species)
  7. 402810Species Thermus thermophilus [TaxId:274] [102677] (1 PDB entry)
  8. 402812Domain d1v6sb_: 1v6s B: [100425]
    complexed with gol, na

Details for d1v6sb_

PDB Entry: 1v6s (more details), 1.5 Å

PDB Description: Crystal Structure of Phosphoglycerate Kinase from Thermus thermophilus HB8

SCOP Domain Sequences for d1v6sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6sb_ c.86.1.1 (B:) Phosphoglycerate kinase {Thermus thermophilus}
mrtlldldpkgkrvlvrvdynvpvqdgkvqdetrileslptlrhllaggaslvllshlgr
pkgpdpkyslapvgealrahlpearfapfppgseearreaealrpgevlllenvrfepge
ekndpelsaryarlgeafvldafgsahrahasvvgvarllpayagflmekevralsrllk
dperpyavvlggakvsdkigviesllpridrlliggamaftflkalggevgrslveedrl
dlakdllgraealgvrvylpedvvaaerieagvetrvfparaipvpymgldigpktreaf
aralegartvfwngpmgvfevppfdegtlavgqaiaalegaftvvgggdsvaavnrlglk
erfghvstgggasleflekgtlpglevleg

SCOP Domain Coordinates for d1v6sb_:

Click to download the PDB-style file with coordinates for d1v6sb_.
(The format of our PDB-style files is described here.)

Timeline for d1v6sb_: