Lineage for d1v6oh_ (1v6o H:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 555834Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 555962Protein Legume lectin [49904] (23 species)
  7. 556138Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (16 PDB entries)
  8. 556190Domain d1v6oh_: 1v6o H: [100422]
    complexed with ca, mn

Details for d1v6oh_

PDB Entry: 1v6o (more details), 3 Å

PDB Description: peanut lectin complexed with 10mer peptide (pvriwssatg)

SCOP Domain Sequences for d1v6oh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6oh_ b.29.1.1 (H:) Legume lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d1v6oh_:

Click to download the PDB-style file with coordinates for d1v6oh_.
(The format of our PDB-style files is described here.)

Timeline for d1v6oh_: